SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378135|ref|YP_001314730.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378135|ref|YP_001314730.1|
Domain Number 1 Region: 289-490
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000353
Further Details:      
 
Domain Number 2 Region: 801-1019
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.28e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000545
Further Details:      
 
Domain Number 3 Region: 41-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 4.45e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0031
Further Details:      
 
Domain Number 4 Region: 182-262
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000209
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0033
Further Details:      
 
Domain Number 5 Region: 138-181,267-324
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000628
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0051
Further Details:      
 
Domain Number 6 Region: 562-656
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000068
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.014
Further Details:      
 
Domain Number 7 Region: 707-798
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000249
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378135|ref|YP_001314730.1|
Sequence length 1065
Comment acriflavin resistance protein [Sinorhizobium medicae WSM419]
Sequence
MFLTRISINHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVVVVATTYTGASPESVE
SEISRPIEAALNTIGGIDTITSESYEGRSIVVVQFEVDVDSQDAAQEVRDRVARLETKFP
DAVATPQVTRYKPEGQAILSVAVSSTSRTLPEITTLATRVINNRLSVISGVGQVSLIGSS
ERQVLVVVDPDRLGAYGLAVATVIEAIRGENQDRAAGTLTSGINQRIVTVEGRIANTSAF
NRIIVAQRNGYPVYLSEVATILDTGAEVTSLANYQGQTTLGLHIVKVQGANTVEVASAVR
REVSALNAELTKDNVQLTITRDNSRPIASQVSQVQRTLVEGGVLSVLIVFIFLNSWRSTV
ITGLTLPISVIGTFAAIYALGFTLNIMTLMALSLSIGILIDDAIVVRENITRHLQMGKDP
VRAALDGTNEIGLAVLSTTLCIVAVFLPVAFMGGLIGRFFLQFGVTVAVAVFISLFVSFT
LDPMLSSIWRDPQSQKTAKRGFFGQLIERFDQWFEGLASRYRSVIYFTFDYRKTTIAIVL
GMFVVSLLLVPRIGTEFLPPPDQGEVSISLEANEGASLDYMAAKVGQIERALREFNYVSS
TYSTINSGEMRGFNKALVAVQLVHSSQRRLKTAETLGPIRRRLSRIAGLEISVGQRSEVV
GSIKPLQLSILGDGDEELRRISDQITSVLAAIPGATEIESSIEKLRPTLAVRVRREAASD
LGVSIATIGDTLRSLVAGDAISVWNSPDGESHDVVVRLPAAGRENAAQLRNLPIATARMD
DNGKPIMVLLDQVADVVESTAPAQITRKDLSRDIRISSNIEGRTLGDVVADLKAAMTKMD
IPVGFRISFGGDAENLTESTAYALQSLAMAVIFIYIILASQFGSFIQPIAIIMTMPLSLM
GVLLGLLFTGSTLNMFSMIGILMLIGLVTKNAILLVDYSNLGVREGKSLRQSLADAGAVR
LRPIVMTTLAMIFGMLPTALGLGEGGAQRAPMAHAIIGGLISSTLLSLVFVPVVLTYLDA
FARRVRRWVPSPTGSNASAQHDGSDKTKTPACALTSQDQSGTTIM
Download sequence
Identical sequences A6UMB7
366394.Smed_6179 gi|150378135|ref|YP_001314730.1| WP_011970886.1.29075 WP_011970886.1.31871 WP_011970886.1.61285 YP_001314730.1.44884 gi|150378135|ref|YP_001314730.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]