SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378140|ref|YP_001314735.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378140|ref|YP_001314735.1|
Domain Number 1 Region: 16-213
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2e-61
Family NodB-like polysaccharide deacetylase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378140|ref|YP_001314735.1|
Sequence length 217
Comment polysaccharide deacetylase [Sinorhizobium medicae WSM419]
Sequence
MKHLDYIHEVPSNCDYGTEDPSIYLTFDDGPNPHCTPEILDVLAEYGVPATFFVIGTYAK
SQPELIRRIVAEGHEVANHTMTHPDLSTCGPHEVEREIVEASEAIIAACPQAAVRHIRAP
YGVWSEEALTRSASAGLTAIHWSADPRDWSRPGANAIVDAVLASVRPGAIVLLHDGCPPD
ETGALTGLRDQTLMAISRVIPALHERGFAIRPLPPHH
Download sequence
Identical sequences A3QR97 A6UMC2
WP_011970891.1.29075 WP_011970891.1.31871 WP_011970891.1.61285 WP_011970891.1.7720 WP_011970891.1.89664 YP_001314735.1.44884 gi|150378140|ref|YP_001314735.1| gi|150378140|ref|YP_001314735.1|NC_009621 366394.Smed_6185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]