SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378183|ref|YP_001314778.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378183|ref|YP_001314778.1|
Domain Number 1 Region: 6-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.96e-84
Family ABC transporter ATPase domain-like 0.00000163
Further Details:      
 
Domain Number 2 Region: 241-357
Classification Level Classification E-value
Superfamily MOP-like 0.000000000000109
Family ABC-transporter additional domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378183|ref|YP_001314778.1|
Sequence length 359
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MNRPFLQIRGIRKEYGPVTAVQDVTIDVAQGEFLTFLGPSGSGKSTTLYILAGFENPTRG
DILLNGETLLATPSHKRNIGMVFQRYTLFPHLSVGENIAFPLKVRRLRKAEIDAKVRAML
KLVRLEGFEDRKPAQMSGGQQQRVALARALAYDPPVLLMDEPLSALDKKLREEIQHEIRR
IHQQTEVTILYVTHDQEEALRLSDRIAVFSKGVIDQIGTGPELYANPATRFVAEFIGDSD
FLPCDVVSTVNGRADIAVCGSMTISNIPLHGTASSGSKAALMLRPERLLLSKTKSDIGLP
VTVSDITFLGNNVHVATKTRKGNDLSVRLPFGHEAISGLNRGDAVWLRFDAGSAHVFGQ
Download sequence
Identical sequences A6UMG5
gi|150378183|ref|YP_001314778.1| 366394.Smed_6246 gi|150378183|ref|YP_001314778.1|NC_009621 WP_011970932.1.29075 WP_011970932.1.31871 WP_011970932.1.61285 WP_011970932.1.7720 WP_011970932.1.89664 YP_001314778.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]