SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378233|ref|YP_001314828.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378233|ref|YP_001314828.1|
Domain Number 1 Region: 18-133
Classification Level Classification E-value
Superfamily SCP-like 2.83e-20
Family Sterol carrier protein, SCP 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150378233|ref|YP_001314828.1|
Sequence length 168
Comment hypothetical protein Smed_6297 [Sinorhizobium medicae WSM419]
Sequence
MEFPRPLAAPLAVVPIALIEGAVKLMFKSLLNRHPALFDRLGEHRGKRYAFCPLDLPLVF
VVEPSRAAVSVTRKRAAAAADAVVEGPLFLLLTLLEGRCDADALFFSRSLTVTGDMEAML
ALRNALDGCEVDLPRDLGASAGPLSPLVSRTADAIRRRALAGENAAWN
Download sequence
Identical sequences A6UML5
366394.Smed_6297 WP_011970976.1.7720 YP_001314828.1.44884 gi|150378233|ref|YP_001314828.1|NC_009621 gi|150378233|ref|YP_001314828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]