SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378249|ref|YP_001314844.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378249|ref|YP_001314844.1|
Domain Number 1 Region: 19-257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-81
Family ABC transporter ATPase domain-like 0.00000176
Further Details:      
 
Domain Number 2 Region: 252-375
Classification Level Classification E-value
Superfamily MOP-like 0.0000000000034
Family ABC-transporter additional domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150378249|ref|YP_001314844.1|
Sequence length 377
Comment spermidine/putrescine ABC transporter ATPase subunit [Sinorhizobium medicae WSM419]
Sequence
MGVVAADVRRAGSIDQVAVSVKDVGMAFGDVHAVRNASFDLPQGRFLTILGPSGSGKTTL
LRMIAGFDRPTSGEIFINGQPVSAVPPHKRAIGMVFQKLALFPHMTAAENVAFPLKMRRH
DARTIPEKVERYLDLVRLGGYGDRRINELSGGQQQRVAIARALVFEPDLLLLDEPLAALD
RKLREEMQLEFRRIQKELGVTTINVTHDQREALVVSDEIIVMNGGAIQQKARPVDAYRAP
SNAFVANFIGVTNFLEGRIVELTSTQAVFETNGVRLVGIAADAALVAGLSCSGALRAEQI
RIAPRGGRLDELETVVDGQVVDCIFEGDRVVYEIRVPDLAGVLMRVFDHDPESHLQFGPG
DEVRLGWNARDMHVFQK
Download sequence
Identical sequences A6UMN1
gi|150378249|ref|YP_001314844.1| 366394.Smed_6314 WP_011970991.1.29075 WP_011970991.1.89664 YP_001314844.1.44884 gi|150378249|ref|YP_001314844.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]