SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378352|ref|YP_001314946.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150378352|ref|YP_001314946.1|
Domain Number - Region: 294-329
Classification Level Classification E-value
Superfamily MOP-like 0.013
Family ABC-transporter additional domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150378352|ref|YP_001314946.1|
Sequence length 369
Comment calcium/proton exchanger [Sinorhizobium medicae WSM419]
Sequence
MHDSTSTHVPLWSWIIPLLGGVIAALALAHLLPAGSVLIRLTSAALLAGAVFAAVHHAEV
LAERVGEPFGAILLAICVTIIEVAVIVSIMLSGAEGNEEVARDTVFSALMIVLNGVIGLC
LVVGGRRHHEQSFQLNAASAALAVLGTLATLSLVLPNFVIAGQPQQFARIQLAIIGLVSL
VLYGVFLYVQTVRHRDYFMDHTGAIDDGKALPAEHERPKGNMPVTGGLLVLALVAVVLLA
KLLSHPLDSAVDAVGLPQAVVGVVIAGVVLLPEGIASIKAALLNRLQNSVNLVLGSALAS
IGMTVPVVAAISVTLGQNITLGLRPENLVMLVLTLFVSTITLGTGRTTVLQGAVHLSIFV
VFLLLSAVP
Download sequence
Identical sequences A6UMY3
gi|150378352|ref|YP_001314946.1|NC_009622 WP_011971059.1.29075 YP_001314946.1.44884 gi|150378352|ref|YP_001314946.1| 366394.Smed_6447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]