SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378385|ref|YP_001314979.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378385|ref|YP_001314979.1|
Domain Number 1 Region: 77-167
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.92e-19
Family ParB-like nuclease domain 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|150378385|ref|YP_001314979.1|
Domain Number - Region: 159-220
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000889
Family KorB DNA-binding domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378385|ref|YP_001314979.1|
Sequence length 340
Comment parB-like partition protein [Sinorhizobium medicae WSM419]
Sequence
MSRKHILGVSTDAPDTSSADNRTAKSRSMPLLGVVRKERDPSTKLTANIGNALREQNDRL
GRAEEIERRLAEGQAVVELDASFIEPSFVQDRMQGDIDGLVASIREQGQQVPILVRPHPD
QPSRYQVAFGHRRLRAVSDLGLPVKAVVRDLTDEQLVVAQGQENNEREDLTFIEKARFAH
RLNKQFSREIVIAAMSIDKSNLSKMLLIVDVLPSELIDAIGAAPGVGRPSWHQLAELVEK
AASPSDAIKFAASAEVQALPSPDRFKAVIRHLKPRRIARGLPDVMSTPDGDRLAQVTQSR
SKLEITIDRKATPDFAAFVLEHLPALYQSHRAKHQRKQGD
Download sequence
Identical sequences A6UN16
gi|150378385|ref|YP_001314979.1|NC_009622 gi|150378385|ref|YP_001314979.1| 366394.Smed_6491 WP_011971031.1.29075 WP_011971031.1.89664 YP_001314979.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]