SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150378397|ref|YP_001314991.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378397|ref|YP_001314991.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000717
Family Cgl2762-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378397|ref|YP_001314991.1|
Sequence length 88
Comment transposase IS3/IS911 family protein [Sinorhizobium medicae WSM419]
Sequence
MKKQRFTEEQIIAVLKEQEAGAKVADLCRKHGISDATFYNWKAKFGGMEVSEAKRLKALE
EENAKLKKLLAEQMLDAAALRELLAKKW
Download sequence
Identical sequences A6UDG1
gi|150377774|ref|YP_001314369.1| gi|150378180|ref|YP_001314775.1| gi|150378397|ref|YP_001314991.1| gi|150398059|ref|YP_001328526.1| YP_001314369.1.44884 YP_001314775.1.44884 YP_001314991.1.44884 YP_001328526.1.44884 gi|150377774|ref|YP_001314369.1|NC_009621 gi|150378180|ref|YP_001314775.1|NC_009621 gi|150378397|ref|YP_001314991.1|NC_009622 366394.Smed_2861 366394.Smed_5715 366394.Smed_6241 366394.Smed_6507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]