SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395238|ref|YP_001325705.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395238|ref|YP_001325705.1|
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.5e-46
Family Ribonuclease PH domain 1-like 0.00000485
Further Details:      
 
Domain Number 2 Region: 156-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.33e-23
Family Ribonuclease PH domain 2-like 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395238|ref|YP_001325705.1|
Sequence length 239
Comment ribonuclease PH [Sinorhizobium medicae WSM419]
Sequence
MRPSGRKTDQMRKVSFERNFSKHAEGSCLVRFGDTHVLCTASLEDKVPGWLRNGGKGWVT
AEYGMLPRATGERMRREASAGKQSGRTQEIQRLIGRSLRAVVDLPALGERQISVDCDVIQ
ADGGTRTASITGAWIALHDCLKWMEARNMVKLEKVLKDHVAAISCGIFASQPVVDLDYLE
DSAAETDANFVMTGSGGLVEIQGTAEGKPFSEEEFASLMLLAKNGIAELIEMQKLAIAG
Download sequence
Identical sequences A6U5E0
WP_011974225.1.29075 WP_011974225.1.31871 WP_011974225.1.61285 WP_011974225.1.7720 WP_011974225.1.89664 YP_001325705.1.44884 gi|150395238|ref|YP_001325705.1| 366394.Smed_0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]