SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395259|ref|YP_001325726.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395259|ref|YP_001325726.1|
Domain Number 1 Region: 11-202
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.31e-30
Family GlnE-like domain 0.076
Further Details:      
 
Domain Number 2 Region: 393-637
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 3.26e-23
Family Poly A polymerase C-terminal region-like 0.018
Further Details:      
 
Domain Number 3 Region: 841-911
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000874
Family Glycine cleavage system transcriptional repressor 0.058
Further Details:      
 
Domain Number 4 Region: 732-790
Classification Level Classification E-value
Superfamily ACT-like 0.00000000262
Family Glycine cleavage system transcriptional repressor 0.087
Further Details:      
 
Domain Number 5 Region: 221-334
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00000000298
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395259|ref|YP_001325726.1|
Sequence length 949
Comment PII uridylyl-transferase [Sinorhizobium medicae WSM419]
Sequence
MARHETSFPEILDVAALRARCDFIASAHAEQREPMRRALLAAFKEANIAGRAKARELLAA
DGAGIKCAERISWLQDQLITLLHDFVLNQVFDAAKAPETSRIAVTAVGGYGRGTLAPGSD
IDLLFLLPAKKAVWAEPAIEFMLYILWDLGFKVGHATRTIEDCIRLSRADMTIRTAILEC
RYVCGSVALASELETRFDHEIVRNTGPEFIAAKLAERDERHRKAGDTRYLVEPNVKEGKG
GLRDLHTLFWISKYFYRVKDSADLVKLGVLSRQEYKLFQKAEDFLWAVRCHMHFLTGKAE
ERLSFDIQREIAEALGYHDHPGLSAVERFMKHYFLVAKDVGDLTRIFCSALEDQQAKDAP
GISGVISRFRNRVRKIPGTLDFVDDGGRIALASPDVFKRDPVNLLRMFHIADINGLEFHP
AALKQVTRSLSLITPHLRENEEANRLFLSILTSRRNPELILRRMNEAAVLGRFIPEFGKI
VSMMQFNMYHHYTVDEHLLRAVDVLSRIERGLEEEAHPLTAMLMPAIEDREALYVAVLLH
DIAKGRPEDHSVAGAKVARKLCPRFRLSPKQTETVVWLVEEHLTMSMVAQTRDLNDRKTI
VDFAERVQSLERLKMLLILTVCDIRAVGPGVWNGWKGQLLRTLYYETELLLSGGFSELSR
KERAKHAADMLEEALADWPKEERQTYVRLHYQPYLLTVALDEQVRHAAFIREADAAGRTL
ATMVRTHDFHAITEITVLSPDHPRLLTVIAGACAAAGANIVGAQIHTTSDGRALDTILVN
REFSVAEDETRRAASIGKLIEDVLSGRKKLPDVIASRTRSKKRSRAFTVTPEVTISNALS
NKFTVIEVEGLDRTGLLSEVTAVLSDLSLDIASAHITTFGEKVIDTFYVTDLVGSKITSE
NRQMNIAARLKAVLAGEVDEARERMPSGIIAPTPVPRASHGSKATKAET
Download sequence
Identical sequences A6U5G1
366394.Smed_0031 gi|150395259|ref|YP_001325726.1| WP_011974246.1.29075 WP_011974246.1.31871 WP_011974246.1.61285 WP_011974246.1.7720 WP_011974246.1.89664 YP_001325726.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]