SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395271|ref|YP_001325738.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395271|ref|YP_001325738.1|
Domain Number 1 Region: 89-153,193-273
Classification Level Classification E-value
Superfamily CBS-domain pair 1.22e-31
Family CBS-domain pair 0.0053
Further Details:      
 
Domain Number 2 Region: 273-357
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.13e-18
Family CorC/HlyC domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395271|ref|YP_001325738.1|
Sequence length 391
Comment hypothetical protein Smed_0043 [Sinorhizobium medicae WSM419]
Sequence
MSDFKTEPAAVATEEAEASGDAEAGSSTAARSEGSKSTSSFWSRAARLLRGVSPSSLRED
LADALMTDTGGNAAFSPEERAMLNNILRFREVRVEDVMVPRADIEAVDQNITIGELMALF
EESGRSRMPVYSEGLDDPRGMVHIRDLLAYVAKQARNRRRNGKAPTAPTTATTTNGDKPE
KAPRQQKPGFDLSRVDLDKTVEEAGIIRQLLFVPPSMLASDLMQRMRAARIQMALVIDEY
GGTDGLVSLEDIVEMVVGDIEDEHDDEEVMFARSSDDVFIADARVELEEIAEAVGPDFDV
REQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQILDADPRRVKRVRIMRKRPSSRR
RPPKVEKEPLPEAFATTGATGAGVRPPASLE
Download sequence
Identical sequences A6U5H3
366394.Smed_0043 WP_011974258.1.29075 WP_011974258.1.31871 WP_011974258.1.61285 WP_011974258.1.7720 YP_001325738.1.44884 gi|150395271|ref|YP_001325738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]