SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395290|ref|YP_001325757.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395290|ref|YP_001325757.1|
Domain Number 1 Region: 299-499
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.09e-53
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000269
Further Details:      
 
Domain Number 2 Region: 841-1037
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.35e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000634
Further Details:      
 
Domain Number 3 Region: 138-184,277-333
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.51e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0035
Further Details:      
 
Domain Number 4 Region: 682-731,818-867
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.46e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0017
Further Details:      
 
Domain Number 5 Region: 41-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.14e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00015
Further Details:      
 
Domain Number 6 Region: 575-681
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.66e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00093
Further Details:      
 
Domain Number 7 Region: 185-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.66e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0003
Further Details:      
 
Domain Number 8 Region: 732-818
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.79e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395290|ref|YP_001325757.1|
Sequence length 1061
Comment hydrophobe/amphiphile efflux-1 (HAE1) family protein [Sinorhizobium medicae WSM419]
Sequence
MNFSRFFVDRPVFAGVLSVIIFVAGLIGMTGLPISEYPEVVPPQIVVRAQYPGANPAVIA
ETVATPLEEQINGVEGMLYMQSQATADGLMTLTVTFELGTDPDQAQQLVQNRVSQAEPRL
PEEVRRLGVTTVKSSPDLTLVVHLISPNGQYDINYLRNYGVLNVKDRLARVDGVGQVQIF
GGGDYSMRVWIDPEKAAERGLAASDIANAVRGQNVQAAAGVIGASPSVPGLDLQLSVNAQ
GRLKTPEDFADIVVKSGEGGEITRLGDVARVEMGAADYSLRSLLDNKAAVGMGVFQAPGS
NAIEISENVHKVMAELKQTMPEGVDYEIVYDTTQFVRASIESVIHTLLEAIALVVIVVIV
FLQTWRASIIPLVAVPVSIVGTFAVMYVFGFSINALSLFGLVLAIGIVVDDAIVVVENVE
RNISQGLSPVQATYRAMQEVSGPIIAIALVLVAVFVPLAFITGLTGQFYRQFALTIAIST
VISALNSLTLSPALAALLLKDHHAPKDWLTRVMDGLFGWFFRGFNRFFGASSEAYGRGVG
GILTRKSLVMGVYVVLLGVTFVLFRAVPGGFVPAQDKQYLIGFAQLPDAATLDRSEDVIR
RMSEIALKHPGVEHAIAFPGLSINGFTNSSNSGIVFVSLKPFEERKTAELSGGAIAMQLN
QEFGAIQDAFIAMFPPPPVQGLGTTGGFKLQIEDRNGLGYRALDDAAKAVLAKAMAAPEL
AGLYSSFQINVPQLYADLDRTKARQLGVAVTDVFETLQIYLGSLYVNDFNAFGRTYSVRI
QADASYRSHADDIGKLKVRSQTGEMIPLSALLNIEQTVGAERAIRYNGFLAADINGGPAP
GFSSGQAQAAIERIAAETLPPGITYEWTDLTYQQILAGNSGILVFPLALLLVYLVLAAQY
ESLLLPIAIILIVPMGIMAALTGVWLTGGDNNVFTQIGLIVLVGLSAKNAILIVEFAREL
ELSGSNAVSAAIEASRLRLRPILMTSMAFIMGVVPLVTSTGAGAEMRSAMGVAVFAGMIG
VTAFGIFMTPVFYVLIRKVSGERPLKHTGAHLEAPHLAPGE
Download sequence
Identical sequences A6U5J2
366394.Smed_0062 gi|150395290|ref|YP_001325757.1| WP_011974276.1.29075 WP_011974276.1.7720 YP_001325757.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]