SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395308|ref|YP_001325775.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395308|ref|YP_001325775.1|
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-23
Family RNase P protein 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395308|ref|YP_001325775.1|
Sequence length 132
Comment ribonuclease P [Sinorhizobium medicae WSM419]
Sequence
MSGQMTTDKDKIAVGRLKSRPQFLAVRAGESRRGPLFLLEVLDRNDPEGEARVGFTVTKK
HGNAVERNRMRRRLKEAVRLSAGFAMKPGHDYVIVARRDLLNAPFDALTRALRDRIEIKP
KQKRPPAGSRKS
Download sequence
Identical sequences A6U5L0
gi|150395308|ref|YP_001325775.1| WP_011974294.1.7720 YP_001325775.1.44884 366394.Smed_0080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]