SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395319|ref|YP_001325786.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395319|ref|YP_001325786.1|
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-39
Family YigZ N-terminal domain-like 0.0000227
Further Details:      
 
Domain Number 2 Region: 126-193
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000115
Family YigZ C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395319|ref|YP_001325786.1|
Sequence length 194
Comment hypothetical protein Smed_0091 [Sinorhizobium medicae WSM419]
Sequence
MFTLQRIESSTQEIRKSRFLAIAGPVEDEQSAKAFLAAHADPAANHNCWAWRVGQNYRFS
DDGEPGGTAGKPILSAIDGQSLDRVAVVVTRWFGGILLGSGGLVRAYGGTAALCLRAAEK
IELVERQRAEIACDFADLALIRARLAARGVTTAAETFTDTGSVLSVEIPQNAVDEVSALV
SDLSRGKALLKLCD
Download sequence
Identical sequences A6U5M1
366394.Smed_0091 gi|150395319|ref|YP_001325786.1| WP_011974304.1.29075 WP_011974304.1.31871 WP_011974304.1.61285 WP_011974304.1.7720 WP_011974304.1.89664 YP_001325786.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]