SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395358|ref|YP_001325825.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395358|ref|YP_001325825.1|
Domain Number 1 Region: 5-127
Classification Level Classification E-value
Superfamily ApaG-like 1.83e-50
Family ApaG-like 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395358|ref|YP_001325825.1|
Sequence length 130
Comment ApaG protein [Sinorhizobium medicae WSM419]
Sequence
MYRALTHDIEVTVEPYYLEEQSDPDDSRYVWGYRIIIANHSDVAVRLMTRYWHITDENGQ
VDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSMEAEGGETFNVAIPAFSL
DSPGLVRTLN
Download sequence
Identical sequences A6U5R0
WP_011974342.1.29075 WP_011974342.1.61285 WP_011974342.1.7720 WP_011974342.1.89664 YP_001325825.1.44884 gi|150395358|ref|YP_001325825.1| 366394.Smed_0130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]