SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395410|ref|YP_001325877.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395410|ref|YP_001325877.1|
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-84
Family ABC transporter ATPase domain-like 0.000000135
Further Details:      
 
Domain Number 2 Region: 236-357
Classification Level Classification E-value
Superfamily MOP-like 5.83e-27
Family ABC-transporter additional domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395410|ref|YP_001325877.1|
Sequence length 359
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MTAIALRQIRKTYGSLQVIHDVDIDIESGEFLVLVGPSGCGKSTLLRMIAGLEEISGGIL
DIGGKVVNALPPSDRDIAMVFQDYALYPHMSVRENMAFGLKMRGTDDETIEKRVSHAAGI
LKIQPFLDRRPAQLSGGQRQRVAMGRAIVREPSAFLFDEPLSNLDAALRVEMRLEIAKLH
NRMKATTVYVTHDQVEAMTLADRIVVLNAGKIEQIGPPLDLYHRPASLFVARFIGSPTMN
TLPAKVVSDGGGSAIRLKERTLQLVGWSGQPIRAGEVTFGIRPEDLVVCRPEDAWFSGEL
AVAERLGSQTYGYVEIGEERMLTVEFPRSTPIRVGEPIHVRPNMEAIHLFDTATGLRKT
Download sequence
Identical sequences A6U5W2
gi|150395410|ref|YP_001325877.1| 366394.Smed_0183 WP_011974394.1.29075 WP_011974394.1.7720 YP_001325877.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]