SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395421|ref|YP_001325888.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395421|ref|YP_001325888.1|
Domain Number 1 Region: 254-476
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.77e-18
Family Arylsulfatase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395421|ref|YP_001325888.1|
Sequence length 530
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MALIPFQLHDYPLALTLGCYLLACAVIFHTDRFALPARERRKNAPRYGRHHDRIDRLARL
PVIALVFAGFFAISWRPLYAAAGTMSFFIIFTGISRAKYKFIREPLVFSDIALVADVFKY
KSIFYATSLNVVFWIVAFLYVFGVSGLYMYFEPAILPERNRLFWVLVLIGIAAGPWALLF
YGPVNRPTAALVQRLVKAINVKINTVRFGTFASVVFHFIIWLGVKRDKIVAELSGMLRAA
VHDLIGHEEAPLIVVWQSESFIDMRHFGVDSIKLPTIDRLRKQAVQWGRLSNVFEGGYTL
RTEFAVLSGLVPDDIHVDASYPYLRAAHYADVVWPGKLKRAGWRTHFIHPYDRTFFLRHK
AMPLLGFEKLTMLDAFDHNPERDGLYVSDATLAARVLSEVQKLPEEESGFFFVASMANHG
PWEPGRVGTLTNPVDIYLAILEQSDAALKQLVDGLNKLDRPVWLVFYGDHAPLLKSFADP
FPDPRSDYFIVPLAKARASAHSSKQAKDEDPWNLLGSMLKHANLHKDALQ
Download sequence
Identical sequences A6U5X3
gi|150395421|ref|YP_001325888.1| 366394.Smed_0194 WP_011974405.1.29075 WP_011974405.1.61285 WP_011974405.1.7720 WP_011974405.1.89664 YP_001325888.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]