SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395494|ref|YP_001325961.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395494|ref|YP_001325961.1|
Domain Number 1 Region: 1-394
Classification Level Classification E-value
Superfamily Phase 1 flagellin 4.18e-64
Family Phase 1 flagellin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395494|ref|YP_001325961.1|
Sequence length 395
Comment flagellin domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MTSILTNVAAMAALQTLRGIDSNMEETQARVSSGLRVGTASDNAAYWSIATTMRSDNMAL
SAVQDALGLGAAKVDTAYAGVENAVEVVKEIRAKLVAATEDGVDKAKIQEEIEQLKQQLT
SIATAASFSGENWLQADITTPVTKSVVGSFVRDSSGVVSVKTIDYVLDGNSVLFDTVGNT
GILDKVYDVSESSVTLSINTGGVVSEHTVAAYTVDDLIAGGAVFQNNYALAGGVSYVQVE
GAWVRAVASSTVPGQEVAAVTTAAAPITADSWIVDTTAGPAASVPAPASVENIDITDATQ
AANLDALIRGVDEALEDLISATSALGSISMRIGMQEEFVSKLTDSIDSGIGRLVDADMNE
ESTRLKALQTQQQLAIQSLSIANTNSENILQLFRQ
Download sequence
Identical sequences A6U646
WP_011974477.1.7720 YP_001325961.1.44884 gi|150395494|ref|YP_001325961.1| 366394.Smed_0267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]