SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395504|ref|YP_001325971.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395504|ref|YP_001325971.1|
Domain Number 1 Region: 64-271,354-469
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0000000719
Family Phase 1 flagellin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395504|ref|YP_001325971.1|
Sequence length 472
Comment flagellar hook-associated protein FlgK [Sinorhizobium medicae WSM419]
Sequence
MSLSSAIAIAQSAFSTTAQQTATVSKNIANSGNADYSRRMAMLGTTPGGAQIVSIYRAQN
EALLKQNLISISQSSAQSSLLSGLEIMKSALGGNDYESAPSTYLSAFRNSLQTFASTPGN
ATIAATVVSDASDLANSISRTSAAVQDLRLDTDKKIAEDVANLNRLLAQFETANNAVRQA
TAAGTDATAALDDRDRILKQVSELVGISTVTRANNDTVIYTAGGTVLFETLPREVTFAPK
SAYDATVTGNGIFIDGVPLAAGNGADTNAQGKLAGLLQLRDDIAPTFQTQLDEMARGLVS
LFQEGGLPGLFTWSGGNVPAAGAVEAGIAAYLSVNPAAKSNPFLLRDGGFNGIVSNPGNN
AGFTDLLDSFVAAMDGDMAFDSAAGLDGTSSIMEFAASSVGWFEQIRSGASTADDNKAAL
LARTQEALGSVTGVSIDEELSLLLDLEQSYKASAKLISTVDAMMASLLEAVR
Download sequence
Identical sequences A6U656
WP_011974487.1.29075 WP_011974487.1.7720 YP_001325971.1.44884 gi|150395504|ref|YP_001325971.1| 366394.Smed_0277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]