SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395522|ref|YP_001325989.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395522|ref|YP_001325989.1|
Domain Number 1 Region: 13-475
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4e-133
Family Amylase, catalytic domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 478-550
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000304
Family alpha-Amylases, C-terminal beta-sheet domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395522|ref|YP_001325989.1|
Sequence length 551
Comment alpha amylase [Sinorhizobium medicae WSM419]
Sequence
MTLSETTSSLLEPDRDWWRGAVIYQIYPRSFQDTNGDGIGDLQGITARLPHIAGLGADAI
WISPFFTSPMKDFGYDVSNYVDVDPIFGALDDFDALIAEAHRLGLRVMIDLVLSHSSDQH
PWFVESRSTRSNAKADWYVWADSKPDGTPPNNWLSIFGGSAWQWDPTRLQYYLHNFLISQ
PDLNLHNSEVQDALLSVARFWLERGVDGFRLDTINFYFHDRELRDNPALAPERRNASTAP
AVNPYNYQEHIYDKNRPENLEFLQRFRALMDEFPAIAAVGEVGDSQRGLDIAAEYTSGGD
KVHMCYAFEFLAPDQLTPQRVAEVLRDFQRAAPEGWACWAFSNHDVVRHISRWAHGVTSR
DAHAKLLASLLMSLRGSVCIYQGEELALAEAELAYEDLKDPYGIQFWPDFKGRDGCRTPM
VWESLPDGGFSSTRPWLPICKSHVPGAVAVQESDPNSVLHHYRRFLAFRKAHRAFAKGEI
EFVETKGALLGFLRIHGDEKLFCLFNMSDQPATKELPIKRLEPLDGHGFVFEIMDHEVKL
PAWGAFFARLA
Download sequence
Identical sequences A6U674
gi|150395522|ref|YP_001325989.1| 366394.Smed_0295 WP_011974504.1.29075 WP_011974504.1.7720 YP_001325989.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]