SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395523|ref|YP_001325990.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395523|ref|YP_001325990.1|
Domain Number 1 Region: 5-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.92e-83
Family ABC transporter ATPase domain-like 0.000000122
Further Details:      
 
Domain Number 2 Region: 237-359
Classification Level Classification E-value
Superfamily MOP-like 6.07e-27
Family ABC-transporter additional domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395523|ref|YP_001325990.1|
Sequence length 362
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MTGLLLKNIRKSYGAVDVIHGINLEIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDM
FIAGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRAAADM
LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS
EQMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAM
NVIPAAITATGQQTAVTLAGGKSVTLDIPTNASENGKTASFGVRPEDLQVTGTDDFLFEG
TVSIVEALGEVTLLYIEGLVENEPIIAKMPGIAQVGRGDKVRFTADKAKLHLFDTRGQSY
RA
Download sequence
Identical sequences A6U675
WP_011974505.1.29075 WP_011974505.1.7720 YP_001325990.1.44884 gi|150395523|ref|YP_001325990.1| 366394.Smed_0296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]