SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395538|ref|YP_001326005.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395538|ref|YP_001326005.1|
Domain Number 1 Region: 22-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-90
Family ABC transporter ATPase domain-like 0.000000771
Further Details:      
 
Domain Number 2 Region: 255-378
Classification Level Classification E-value
Superfamily MOP-like 3.53e-18
Family ABC-transporter additional domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395538|ref|YP_001326005.1|
Sequence length 380
Comment spermidine/putrescine ABC transporter ATPase [Sinorhizobium medicae WSM419]
Sequence
MKSLGSIRRSFAPWADPASKPFISFKNVTKKFGDFTAVDDLSLNIYTREFFALLGASGCG
KSTLLRMLAGFEQPTSGEIILDGQSLTGIPPYRRPVNMMFQSYALFPHMTVENNVAFGLK
QDRMPKADIAERVAQMLKLVKLEKFAKRKPHQLSGGQRQRVALARSLAKRPKVLLLDEPL
GALDKKLREETQFELMDLQQELGLTFVVVTHDQEEAMTMADRIAVMSHGKVVQVATPAEI
YEAPNSRFVADFIGDVNIFDGSVTSAGDGYVVIETTGAISVRMASAEKPAKGARAAVAIR
PEKIRLSRQAPAHAPTNAAEGEIWDIGYLGDMTVFHIRLKDGKVIKASSLNAVRAVEDPL
GYDQQVWVSFGEDAGVVLKD
Download sequence
Identical sequences A6U690
WP_011974519.1.61285 WP_011974519.1.7720 YP_001326005.1.44884 366394.Smed_0311 gi|150395538|ref|YP_001326005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]