SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395548|ref|YP_001326015.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395548|ref|YP_001326015.1|
Domain Number 1 Region: 8-182
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.25e-41
Family FAD-linked oxidases, N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395548|ref|YP_001326015.1|
Sequence length 412
Comment FAD-linked oxidoreductase [Sinorhizobium medicae WSM419]
Sequence
MAFEKGGVWRNWVGNQYCVSQYKAAPETEAELAELVAEADKRDLGVRVSGSGHSFTPVVG
TSGLLLSLENLRGVQNVDKERRQITVAGGTRINEVGKTLKQHGLSLINQGDIDSQAVAGA
FTTGTHGTGIKLGNMASSIAGMRIVKANGEILDIDGSDTELLHAAQVSVGTLGVISSMTL
NVMDAYNLHERLWRDDFETCMERHDELAENHRHFGFFWCPTPESRHLYCLPDTAAVSSTD
KLADVCEMKVMDITDATPMESAFEKIAYSSEVYPIEYVPNFVELEYAVPLEHGKAAVRAV
RDLMLNKHTNCIYPIEYRFTAGDPAWMSPFHHQDSITLSVSGGPGIDYWAFLRDVDQILR
GYDSRPHWGKMHFLDTEDVTHLYPRAGDFRALRRELDPNGRFLNEHLKMLLG
Download sequence
Identical sequences A6U6A0
366394.Smed_0322 WP_011974529.1.7720 YP_001326015.1.44884 gi|150395548|ref|YP_001326015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]