SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395577|ref|YP_001326044.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150395577|ref|YP_001326044.1|
Domain Number - Region: 58-116
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00216
Family TolA 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395577|ref|YP_001326044.1|
Sequence length 146
Comment hypothetical protein Smed_0351 [Sinorhizobium medicae WSM419]
Sequence
MLQPSSNLLASPSWDSGIFGSGLTTMRMARLACTCLILVLAGAERLHAEPLYTVDDLGAA
LSRCWTPPAGFKDSFVTLRFGFRGDGTLMGPPRPTAIRVSGDEKQRQAFVAAATEALQNC
VPLEFAKELSDEIAGNVFTLQFKSAP
Download sequence
Identical sequences A6U6C9
gi|150395577|ref|YP_001326044.1| 366394.Smed_0351 WP_011974557.1.29075 WP_011974557.1.61285 WP_011974557.1.7720 WP_011974557.1.89664 YP_001326044.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]