SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395602|ref|YP_001326069.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395602|ref|YP_001326069.1|
Domain Number 1 Region: 5-188,239-446
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-61
Family LacY-like proton/sugar symporter 0.052
Further Details:      
 
Weak hits

Sequence:  gi|150395602|ref|YP_001326069.1|
Domain Number - Region: 201-250
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.019
Family GHMP Kinase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395602|ref|YP_001326069.1|
Sequence length 470
Comment EmrB/QacA family drug resistance transporter [Sinorhizobium medicae WSM419]
Sequence
MNRIVPMILAIALFMEQMDSTVIATSLPAIARDIGVGPITLKLALTSYMVALAIFIPLSG
WMADRFGAKRIFRAAILVFVAGSVFCAVADSLSAFVLSRFLQGVGGAMMTPVARLVLVRS
APRSELVSAMALLTIPALVGPLAGPPLGGFITTYFSWHWIFLINVPVGIVGYFLSGIYLP
EMERRNPPPVDIVGFLLGGTAAAGVIFGLSVISLPALPPAIGIASVSAGIAASFLYIFHA
RRHPAPVLDLKLFRDGAFRAASIGGTIFRISVGAVPFLMPLMLQVGFGLDPFQSGLITFV
GAVGAITTKFLARRVLAFAGFRTTLLVAAVIAAVTTFANGFFTPATPYLVLISVLLIAGF
ARSFFFTGVNALSFADIDDADASKATSMSAVLQQISLALGVAVAGAILEIETAISGKPLE
LGDFHTAFMIIAIANLLAAIPFIAMAKNAGASVSGHRLAIREVETRAAGK
Download sequence
Identical sequences A6U6F4
gi|150395602|ref|YP_001326069.1| WP_011974582.1.61285 WP_011974582.1.7720 YP_001326069.1.44884 366394.Smed_0377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]