SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395615|ref|YP_001326082.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395615|ref|YP_001326082.1|
Domain Number 1 Region: 12-154
Classification Level Classification E-value
Superfamily Nudix 1.35e-18
Family MutT-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395615|ref|YP_001326082.1|
Sequence length 168
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MNFLHRLASDVQLMLRRPARMQYAALCYRFTAKTKALEILVITSRDTGRWVIPKGWPMQG
KQAHEVAEREAYEEAGVKGKVQRAAVGAYVYQKRMDHGLEISCKVQVHALEVEAFCKKFP
EKGTRRLEWVDYKEAAKRVAEPSLKELILDFGKRVDPAAEQRPKEPSS
Download sequence
Identical sequences A6U6G7
gi|150395615|ref|YP_001326082.1| WP_011974595.1.61285 WP_011974595.1.7720 WP_011974595.1.89664 YP_001326082.1.44884 366394.Smed_0390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]