SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395620|ref|YP_001326087.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395620|ref|YP_001326087.1|
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.94e-37
Family FAD-linked oxidases, N-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 197-401
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 6.05e-19
Family Vanillyl-alcohol oxidase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395620|ref|YP_001326087.1|
Sequence length 405
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MIVHFDPASEEGIASVVRSAAAERVTLAVVGGGTRAGLGNPVRADRTLSTRRLSGIGTYD
PAEMTMSALAGTPLAEVEAALRAKGQMLSFEPMDHRPISGTAGEPTIGGVFAANASGPRR
YVAGAARDSLLGVRFVNGRGELIKAGGRVMKNVTGLDLVKLMAGSYGTLGILTEVTFKVL
PLPPAAATVIVSGLNDAEAAAVMAEAMAQPVEVSGAAHLPESVRGRFLDGNLPDGAATAL
RLEGLAASVAVRTEKLGEKLTRFGRVSQLGEAETMALWAEIRDVKPYADGSRRPLWRVSV
APSAGHQLIAALRLQTGVDAFYDWQGGLVWLRMEADPEAELLRRYIGAVGGGHATLLRAE
EEARGRIPAFEPQPPAVAQLSERVRAKFDPSGILNPGRVAPLTRK
Download sequence
Identical sequences A6U6H2
366394.Smed_0395 gi|150395620|ref|YP_001326087.1| WP_011974600.1.29075 WP_011974600.1.7720 YP_001326087.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]