SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395653|ref|YP_001326120.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395653|ref|YP_001326120.1|
Domain Number 1 Region: 414-604
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.75e-57
Family DNA mismatch repair protein MutL 0.0073
Further Details:      
 
Domain Number 2 Region: 2-201
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-46
Family DNA gyrase/MutL, N-terminal domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 196-324
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-35
Family DNA gyrase/MutL, second domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395653|ref|YP_001326120.1|
Sequence length 605
Comment DNA mismatch repair protein [Sinorhizobium medicae WSM419]
Sequence
MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIATAGGGKTLLRVTDNG
LGMSPADLELAIRRHCTSKLDGSLADIRTLGFRGEALPSIGSVARLSITTRTAEAREGAT
ITITGGRSDPVRPSAAVVGTVVEVRELFFATPARLKFMKSERAETAAISEVVRRMAIAFP
KVRFVLSGSDRSALEFPATGDDRLARMAQVLGRDFRDNAIEIDAEREGARLTGFAGVPTF
NRGNSLQQYAFVNGRPVQDKLIMSAIRAAYAETVPQGRYPVAVLSLTIDPALVDVNVHPA
KSDVRFRDPGLIRGLIIGAIREALMREGDRAATTGAQGLMRAFRPEFHRGDQQRPQEPWT
AATSPYRPFSPGGAARGFAETPQAAFSDFAQPSARNAAVPVDSIQAADGQAASFPLGAAR
AQLHENYIVAQTDDGLVIVDQHAAHERLVFETMRTALHARPVPAQALLIPEIVDLPEEDC
DRLVAHAGEFTRLGLAIERFGPAAIAVRETPAMLGEMDAAGLVRQLADELAEWDTADGLA
GRLEYLAATMACHGSVRSGRRLRTEEMNALLRRMEATPGSGQCNHGRPTYIELKLADIER
LFGRS
Download sequence
Identical sequences A6U6K5
366394.Smed_0428 gi|150395653|ref|YP_001326120.1| WP_011974632.1.29075 WP_011974632.1.7720 YP_001326120.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]