SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395681|ref|YP_001326148.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395681|ref|YP_001326148.1|
Domain Number 1 Region: 11-173
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-33
Family GHMP Kinase, N-terminal domain 0.0000729
Further Details:      
 
Domain Number 2 Region: 178-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.47e-27
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395681|ref|YP_001326148.1|
Sequence length 303
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Sinorhizobium medicae WSM419]
Sequence
MRPDGIAGFALTIAAPAKINLALHVVGQRADGHHLLESLVTFAECGDGIGLAAAEADHFT
VSGRFAPDLSPSAENTSGNLVLRARDVLRRELASQGRAAGPVHLHLEKNLPVASGIGGGS
ADAAATLRGLLSLWGASLEPARLGSLALELGADVPMCLDGRPLIARGIGEEITSIPDLPS
FAIVLVNPLVEVSTPVVFRLLIRKSNPPLVLPENLRSTAAWLAALASMRNDLEPPARALE
PMIEAVSTALEDAGATLVRMSGSGATCFGLFADEKSASLAAETISASQPRWYVRATRTAG
KSG
Download sequence
Identical sequences A6U6N3
366394.Smed_0456 gi|150395681|ref|YP_001326148.1| WP_011974659.1.29075 WP_011974659.1.61285 WP_011974659.1.7720 YP_001326148.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]