SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395767|ref|YP_001326234.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395767|ref|YP_001326234.1|
Domain Number 1 Region: 11-230
Classification Level Classification E-value
Superfamily DNA-glycosylase 4.87e-72
Family Mismatch glycosylase 0.0000267
Further Details:      
 
Domain Number 2 Region: 229-362
Classification Level Classification E-value
Superfamily Nudix 1.52e-22
Family MutY C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150395767|ref|YP_001326234.1|
Sequence length 370
Comment A/G-specific adenine glycosylase [Sinorhizobium medicae WSM419]
Sequence
MTPEPATDAAALLLGWYDRHHRDLPWRISPPMARKGAVADPYHVWLSEVMLQQTTVKAVK
AYFQKFLALWPTVGDLAAADTEDVMKAWAGLGYYARARNLKKCAEAVVRDHGGRFPDREE
ELKALPGIGDYTAAAIAAIAFNRRSAVLDGNVERVISRLHAVETPLPAAKPEMRALVHTL
TPLGRPGDFAQAMMDLGATICTPKRPACSLCPFRADCRALKIADPETFPRKAPRKEKPLR
LGAAFVAIDDCEAVYLRKRPETGLLGGMTEIPGTEWTSRRDGDTSVDAHPFPAPWEPCGT
VSHVFTHFELRLSVFRASVVRVSEGGAGAGAAPAGTSGWWEPLDSLKAQALPTVMKKAIA
KAIPHAFAAG
Download sequence
Identical sequences A6U6W9
YP_001326234.1.44884 gi|150395767|ref|YP_001326234.1| 366394.Smed_0543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]