SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395900|ref|YP_001326367.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395900|ref|YP_001326367.1|
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily RPB6/omega subunit-like 2.75e-19
Family RPB6 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395900|ref|YP_001326367.1|
Sequence length 135
Comment DNA-directed RNA polymerase subunit omega [Sinorhizobium medicae WSM419]
Sequence
MARVTVEDCIDKVENRFELVLLASHRARLVSQGAPITVDRDNDKNPVVALREIADETLSP
GDLKEDLIHSLQKHVEVDEPEPDPASLVQTEATPAFAEAAEEEDQPEALTFDRMSEEELL
AGIEGLVPPEKSDDY
Download sequence
Identical sequences A6U7A2
gi|150395900|ref|YP_001326367.1| 366394.Smed_0676 WP_011974878.1.29075 WP_011974878.1.61285 WP_011974878.1.7720 WP_011974878.1.89664 YP_001326367.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]