SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395927|ref|YP_001326394.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395927|ref|YP_001326394.1|
Domain Number 1 Region: 242-313
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-20
Family Nudix-associated domain 0.0034
Further Details:      
 
Domain Number 2 Region: 14-135
Classification Level Classification E-value
Superfamily Nudix 0.0000000568
Family BT0354 N-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395927|ref|YP_001326394.1|
Sequence length 322
Comment hypothetical protein Smed_0703 [Sinorhizobium medicae WSM419]
Sequence
MSGEGPPGTVEIGLNAVIVAVVSRSPRILAVSEPDGDARDSLPFGPFDPARHRTFEASLR
ARVEKRTALKLGYIEQLYTFGDRGRQRLPGEEGKHMVSVGYLALTRTDAENTERLAGAGA
HWRDWYGYLPWEDWRLGRPAILDRTILPALARWESGDEKPAAAQRRSRIRLAFGLDDFPW
DEERVLERYELLYEAGLVREAVIDGHCRDLEPPAAGLAMRHDHRRIVATAVARLRGKLKY
RPVVFELMPPAFTLTDLQATVEAISGRHLHKQNFRRLVEGAELVEPTGETLASTGGRPAA
LFRFRRQILDERPAPGLKVGGR
Download sequence
Identical sequences A6U7C9
366394.Smed_0703 WP_011974905.1.29075 WP_011974905.1.31871 WP_011974905.1.61285 WP_011974905.1.7720 WP_011974905.1.89664 YP_001326394.1.44884 gi|150395927|ref|YP_001326394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]