SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395934|ref|YP_001326401.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395934|ref|YP_001326401.1|
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Nudix 1.35e-31
Family MutT-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150395934|ref|YP_001326401.1|
Sequence length 154
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MMTEQPQRASSAILERNGRYLLVRRANPPSADMYAFPGGRAEPGETPAETALRELAEETG
IEARNPVLFEAYDLPGKGPEERHFLLSVFTVEADPDSVAVACDDAAGLGWFTREEIFDLP
IPESVRDCVEKLATGGHRGNPGFVTATASDLRGS
Download sequence
Identical sequences A6U7D6
gi|150395934|ref|YP_001326401.1| WP_011974911.1.29075 WP_011974911.1.7720 WP_011974911.1.89664 YP_001326401.1.44884 366394.Smed_0710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]