SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395953|ref|YP_001326420.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395953|ref|YP_001326420.1|
Domain Number 1 Region: 65-289
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.67e-51
Family RecA protein-like (ATPase-domain) 0.0081
Further Details:      
 
Domain Number 2 Region: 254-268,302-429
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-36
Family ATP-dependent protease Lon (La), catalytic domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395953|ref|YP_001326420.1|
Sequence length 467
Comment DNA repair protein RadA [Sinorhizobium medicae WSM419]
Sequence
MAKARTQFICQNCGTIHSRWVGKCDGCGEWNTIIEDNPTAGIGGGPMRTPKKGRPVALTT
LSGEIEDAPRIQTGISELDRVTGGGFVRGSALLVGGDPGIGKSTVLMQAAAALARRKHRV
IYVSGEEAIAQVRLRAQRLGAADSDVLLAAETNVEDILATLSEDKRPDLVIIDSIQTLWS
DIVDSAPGTVTQVRTGVQAMIRFAKQTGTAVVLVGHVTKEGQIAGPRVVEHMVDAVLYFE
GDRGHHYRILRTVKNRFGPTDEIGVFEMSDKGLREVVNPSELFLGERNEKSPGAAVFAGM
EGTRPVLVEVQALVAPTSLGTPRRAVVGWDAARLSMILAVLEAHCGIRLGQHDVYLNVAG
GYRISEPAADLAVASALVSSLAGLALPADCVYFGEVSLSGAIRPVAHTAQRLKEAEKLGF
SQAVLPSASTELPKNGNGRWSEMESLPDLVARIAGSRRALQQTNDEE
Download sequence
Identical sequences A6U7F5
WP_011974929.1.29075 WP_011974929.1.31871 WP_011974929.1.61285 WP_011974929.1.7720 WP_011974929.1.89664 YP_001326420.1.44884 366394.Smed_0729 gi|150395953|ref|YP_001326420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]