SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150395955|ref|YP_001326422.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150395955|ref|YP_001326422.1|
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily Regulatory protein AraC 3.66e-18
Family Regulatory protein AraC 0.01
Further Details:      
 
Domain Number 2 Region: 238-284
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000118
Family AraC type transcriptional activator 0.032
Further Details:      
 
Domain Number 3 Region: 186-235
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000851
Family AraC type transcriptional activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150395955|ref|YP_001326422.1|
Sequence length 285
Comment AraC family transcriptional regulator [Sinorhizobium medicae WSM419]
Sequence
METISQEKAIEAMPLEGVERTRFWRDARFKGMECLSATFITHEFAPHAHDTFSIGAIEAG
SQISTIKGERSQTGPGDLYLINPDEIHDGHPGHDGYRYRMIYPSSELLVETIEDVTGRSF
KGTPSFSRLLLTDRELAVGFHRAHRALEGKVGTLEADESMFGFLARLFERHGSAIIVPLQ
TRESSAVHRARDYLVGNYRFDVGLEELAKVAGLSRAHLIRAFRKEFHITPHAFLTDKRVR
EAKALLRKGWSAADTAYYCGFADQAHFSRHFKARTGVTPRAYRSA
Download sequence
Identical sequences A6U7F7
WP_011974931.1.7720 WP_011974931.1.89664 YP_001326422.1.44884 gi|150395955|ref|YP_001326422.1| 366394.Smed_0731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]