SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150396196|ref|YP_001326663.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396196|ref|YP_001326663.1|
Domain Number 1 Region: 6-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.27e-84
Family Ribosomal protein L1 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396196|ref|YP_001326663.1|
Sequence length 232
Comment 50S ribosomal protein L1 [Sinorhizobium medicae WSM419]
Sequence
MAKIAKRVQKSREGVDPAKLYGLTEAVTMIKERATAKFDETIEVAMNLGVDPRHADQMVR
GVVNLPNGTGRSVRVAVFARGAKADEAKAAGADVVGAEELVEIVQGGKIDFDRCIATPDM
MPLVGRLGKVLGPRGMMPNPKVGTVTMDVAGAVKASKGGAVEFRVEKAGIVHAGIGKASF
DAKALEENIRAFADAVIKAKPTGAKGNYVKRVAVSSTMGPGLKIDPATISAA
Download sequence
Identical sequences A6U848
366394.Smed_0975 WP_011975163.1.29075 WP_011975163.1.61285 WP_011975163.1.7720 WP_011975163.1.89664 YP_001326663.1.44884 gi|150396196|ref|YP_001326663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]