SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396197|ref|YP_001326664.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396197|ref|YP_001326664.1|
Domain Number 1 Region: 26-191
Classification Level Classification E-value
Superfamily Ribosomal protein L10-like 7.45e-55
Family Ribosomal protein L10-like 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396197|ref|YP_001326664.1|
Sequence length 195
Comment 50S ribosomal protein L10 [Sinorhizobium medicae WSM419]
Sequence
MIPGDKGKPGRAAMSNPANWRQTVERAEKREFVTELNEVFKASGSVVVAHYAGVTVAQMN
DFRSKMRAAGGTVRVAKNRLAKIALQGTESEGMTDLFRGQTLIAFSEDPVTAPKVVMDFA
KTNDKLVVLGGAMGATTLNAEGVKSLATLPSLDELRAKLLGLLNAPATRVATVVAAPASQ
LARVFSAYAKKDEAA
Download sequence
Identical sequences A6U849
gi|150396197|ref|YP_001326664.1| YP_001326664.1.44884 366394.Smed_0976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]