SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396204|ref|YP_001326671.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396204|ref|YP_001326671.1|
Domain Number 1 Region: 5-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-107
Family G proteins 0.0000000184
Further Details:      
 
Domain Number 2 Region: 483-602
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-41
Family Translational machinery components 0.0000326
Further Details:      
 
Domain Number 3 Region: 269-408
Classification Level Classification E-value
Superfamily Translation proteins 5.89e-35
Family Elongation factors 0.00013
Further Details:      
 
Domain Number 4 Region: 607-693
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-29
Family EF-G/eEF-2 domains III and V 0.0001
Further Details:      
 
Domain Number 5 Region: 408-485
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.55e-25
Family EF-G/eEF-2 domains III and V 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396204|ref|YP_001326671.1|
Sequence length 699
Comment elongation factor G [Sinorhizobium medicae WSM419]
Sequence
MAREYKIEDYRNFGIMAHIDAGKTTTTERILYYTGKSHKIGEVHDGAATMDWMEQEQERG
ITITSAATTTFWKGRDGKSRRFNIIDTPGHVDFTIEVERSLRVLDGAIALLDANAGVEPQ
TETVWRQAEKYNVPRMIFCNKMDKTGADFYRSVEMIKTRLGATAVVMQLPIGAESDFKGV
VDLIEMNALIWRDESLGAQWDVVEIPDDLKEKAEEYREKLIETVVEIDEAAMEAYLEGQY
PDNEQIRALVRRGTIDVKFHPMFCGTAFKNKGVQPLLDAVVDYLPSPVDIPAIKGIDVKT
EAEIERHASDEEPLSMLAFKIMNDPFVGSLTFARIYSGKLEKGTSVMNTVKEKRERVGRM
LQMHSNSREDIEEAFAGDIVALAGLKETTTGDTLCDPLKQVILERMEFPEPVIQIAIEPK
TKGDQEKMGLALNRLAAEDPSFRVKTDEESGQTIIAGMGELHLDILVDRMRREFKVEATV
GAPQVAYRETITRQHEEDYTHKKQSGGTGQFARVKIVFEPNPEGEEFKFESKIVGGAVPK
EYIPGVQKGIESVLSSGPLAGFPMLGVKATLIDGAFHDVDSSVLAFEIASRACFREAAKK
AGAQLLEPIMKVEVVTPEDYVGDVIGDLNSRRGQIQGQEARGVAVVINAHVPLANMFKYV
DNLRSMSQGRAQYTMLFDHYAPVPSNVAQEIQAKYSGQK
Download sequence
Identical sequences A6U856
366394.Smed_0983 WP_011975170.1.29075 WP_011975170.1.31871 WP_011975170.1.61285 WP_011975170.1.7720 WP_011975170.1.89664 YP_001326671.1.44884 gi|150396204|ref|YP_001326671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]