SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396210|ref|YP_001326677.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396210|ref|YP_001326677.1|
Domain Number 1 Region: 127-272
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.87e-60
Family C-terminal domain of ribosomal protein L2 0.00000137
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-45
Family Cold shock DNA-binding domain-like 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150396210|ref|YP_001326677.1|
Sequence length 278
Comment 50S ribosomal protein L2 [Sinorhizobium medicae WSM419]
Sequence
MALKSFNPTTPSQRQLVIVSRAGLYKGKPVKTLTEGLSSKGGRNNLGRITVRFQGGGHKR
TYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALVNYADGEQAYILAPQRLAVGDKVIASE
KAVDVKPGNAMPLQFIPVGSIIHNVEMKPGKGGQIARSAGTYAQLVGRDQGMAILRLNSG
EQRLVHGSCLASIGAVSNPDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRT
SGGRHPVTPWGKPTKGKRTRSNKSTDKFIMRSRHQRKK
Download sequence
Identical sequences A0A0E0UCD1 A0A222J8C1 A6U862 F7X2A9 H0GAA0 Q92QG7
gi|15965112|ref|NP_385465.1| gi|433613130|ref|YP_007189928.1| gi|470188312|ref|YP_007574623.1| NP_385465.1.96377 WP_003536619.1.11889 WP_003536619.1.18618 WP_003536619.1.21755 WP_003536619.1.22199 WP_003536619.1.24285 WP_003536619.1.29075 WP_003536619.1.30341 WP_003536619.1.3038 WP_003536619.1.3110 WP_003536619.1.31871 WP_003536619.1.32135 WP_003536619.1.34728 WP_003536619.1.36091 WP_003536619.1.36292 WP_003536619.1.36834 WP_003536619.1.4234 WP_003536619.1.44594 WP_003536619.1.47143 WP_003536619.1.48083 WP_003536619.1.49828 WP_003536619.1.50755 WP_003536619.1.55094 WP_003536619.1.58221 WP_003536619.1.58608 WP_003536619.1.61285 WP_003536619.1.63001 WP_003536619.1.65778 WP_003536619.1.72343 WP_003536619.1.73540 WP_003536619.1.7720 WP_003536619.1.787 WP_003536619.1.79107 WP_003536619.1.80755 WP_003536619.1.83096 WP_003536619.1.83536 WP_003536619.1.86220 WP_003536619.1.89614 WP_003536619.1.89664 WP_003536619.1.90561 WP_003536619.1.90968 WP_003536619.1.92524 WP_003536619.1.94084 WP_003536619.1.96031 WP_003536619.1.99158 YP_001326677.1.44884 gi|384529070|ref|YP_005713158.1| gi|384536650|ref|YP_005720735.1| gi|407720299|ref|YP_006839961.1| gi|150396210|ref|YP_001326677.1| gi|334315898|ref|YP_004548517.1| 266834.SMc01306 366394.Smed_0989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]