SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396218|ref|YP_001326685.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396218|ref|YP_001326685.1|
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.46e-35
Family Ribosomal proteins L24p and L21e 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396218|ref|YP_001326685.1|
Sequence length 103
Comment 50S ribosomal protein L24 [Sinorhizobium medicae WSM419]
Sequence
MQKIRKGDKVVVLTGKDKGRTGEVIQVMPKEDRAVVRGVNVVKRHQRQTQNQEAGIITKE
APIHLSNIAIADPKDGKPTRVGFKIDGDKKVRVAKRSGDVIDG
Download sequence
Identical sequences A6U870
366394.Smed_0997 WP_011975178.1.29075 WP_011975178.1.31871 WP_011975178.1.61285 WP_011975178.1.7720 WP_011975178.1.89664 YP_001326685.1.44884 gi|150396218|ref|YP_001326685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]