SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396224|ref|YP_001326691.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396224|ref|YP_001326691.1|
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-26
Family Translational machinery components 0.00027
Further Details:      
 
Domain Number 2 Region: 19-87
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.24e-23
Family Ribosomal S5 protein, N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396224|ref|YP_001326691.1|
Sequence length 189
Comment 30S ribosomal protein S5 [Sinorhizobium medicae WSM419]
Sequence
MAQERRGSREDRQNREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG
HGKAREVPEAIRKATEAAKRDLIFVPLRGGRTLHHDVHGRHGAGKVLLRSAKPGTGIIAG
GPMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKNQMHPKDIAAQRGMKYATLQSRR
VSAGVASEE
Download sequence
Identical sequences A0A0E0UB66 A0A220MVE4 A6U876 F7X295 H0GA86 Q92QF3
gi|384529084|ref|YP_005713172.1| gi|407720313|ref|YP_006839975.1| gi|150396224|ref|YP_001326691.1| 266834.SMc01292 366394.Smed_1003 gi|15965126|ref|NP_385479.1| gi|384536636|ref|YP_005720721.1| NP_385479.1.96377 WP_003536510.1.11889 WP_003536510.1.18618 WP_003536510.1.21755 WP_003536510.1.22199 WP_003536510.1.24285 WP_003536510.1.29075 WP_003536510.1.30341 WP_003536510.1.3038 WP_003536510.1.3110 WP_003536510.1.31871 WP_003536510.1.32135 WP_003536510.1.34728 WP_003536510.1.36292 WP_003536510.1.36834 WP_003536510.1.4234 WP_003536510.1.44594 WP_003536510.1.47143 WP_003536510.1.48083 WP_003536510.1.49828 WP_003536510.1.50755 WP_003536510.1.54190 WP_003536510.1.55094 WP_003536510.1.58221 WP_003536510.1.58608 WP_003536510.1.61285 WP_003536510.1.63001 WP_003536510.1.65778 WP_003536510.1.66997 WP_003536510.1.72343 WP_003536510.1.73540 WP_003536510.1.7720 WP_003536510.1.78492 WP_003536510.1.787 WP_003536510.1.79107 WP_003536510.1.80755 WP_003536510.1.83096 WP_003536510.1.83536 WP_003536510.1.86220 WP_003536510.1.89614 WP_003536510.1.89664 WP_003536510.1.90561 WP_003536510.1.90968 WP_003536510.1.92524 WP_003536510.1.94084 WP_003536510.1.96031 YP_001326691.1.44884 gi|470188326|ref|YP_007574637.1| gi|334315912|ref|YP_004548531.1| gi|433613144|ref|YP_007189942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]