SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396232|ref|YP_001326699.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396232|ref|YP_001326699.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily Prokaryotic ribosomal protein L17 6.28e-50
Family Prokaryotic ribosomal protein L17 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396232|ref|YP_001326699.1|
Sequence length 141
Comment 50S ribosomal protein L17 [Sinorhizobium medicae WSM419]
Sequence
MRHGKAGRKLNRTASHRKAMFANMAASLIEHEQIVTTLPKAKEIRPIVEKLVTLGKRGDL
HARRQAVSQIRDVAVVAKLFDAIASRYATRNGGYLRIMKAGFRQGDNAPLAVIEFVDRDA
DAKGSKDRARVAAEAEAAEAA
Download sequence
Identical sequences A6U884
WP_011975188.1.29075 WP_011975188.1.31871 WP_011975188.1.61285 WP_011975188.1.7720 WP_011975188.1.89664 YP_001326699.1.44884 366394.Smed_1011 gi|150396232|ref|YP_001326699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]