SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396283|ref|YP_001326750.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396283|ref|YP_001326750.1|
Domain Number 1 Region: 443-676
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 4.45e-74
Family Type II DNA topoisomerase 0.00045
Further Details:      
 
Domain Number 2 Region: 47-250
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.06e-58
Family DNA gyrase/MutL, N-terminal domain 0.00000379
Further Details:      
 
Domain Number 3 Region: 272-441
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-42
Family DNA gyrase/MutL, second domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396283|ref|YP_001326750.1|
Sequence length 686
Comment DNA topoisomerase IV subunit B [Sinorhizobium medicae WSM419]
Sequence
MDDSSDLFSAMPQQPKPADAAPRKPAAAAAGNEAPRPAPRTSDGSDYDASAIEVLEGLEP
VRRRPGMYIGGTDEKALHHLFAEVIDNSMDEAVAGHANFIDVNLDADGFLTVTDNGRGIP
VENHPKFPGKSTLEVVMTVLHAGGKFDGKAYETSGGLHGVGVSVVNALSDDLEVEVARNR
RLYRQRFSRGVAQGGLEDLGDVHNRRGTRVRFHPDPQIFGPHARFEPARLFRMARSKAYL
FGGVEIRWSCDPSLLPEGSEIPDRAVFHFPGGLKDYLAATLGKEFTVTREIFAGKSEKSN
GHGSLEWAVTWYGGDQQIHSYCNTIPTPEGGTHEAGLRIALTKGLKNYAELTQNKRAAIV
TTDDVMISAAGMLSVFIREPEFVGQTKDRLATVEAQRIVENALRDPFDHYLADNPAEAAK
LLDWVVERAEERVRRRKEKEVSRKTAVRKLRLPGKLADCAQNTAEGAELFIVEGDSAGGS
AKQARNRANQAILPLRGKILNVASAGREKLGANQQIGDLIQALGCGTRSKYREEDLRYER
IVIMTDADVDGAHIASLLITFFYQEMPELIRGGHLFLAVPPLYRLSQGSKTLYARDDAHR
EELMQTEFSGRGKVEIGRFKGLGEMLPAQLKETTMDPAKRTLLKVEIDDVDFEGTRDAVD
SLMGTKAEARFRFIQERAVFAENLDI
Download sequence
Identical sequences A6U8D5
366394.Smed_1062 gi|150396283|ref|YP_001326750.1| WP_011975239.1.29075 WP_011975239.1.31871 WP_011975239.1.61285 WP_011975239.1.89664 YP_001326750.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]