SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396285|ref|YP_001326752.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396285|ref|YP_001326752.1|
Domain Number 1 Region: 12-178
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.5e-35
Family FAD-linked oxidases, N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396285|ref|YP_001326752.1|
Sequence length 441
Comment FAD linked oxidase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MRMDDFESAARSGRRPRPSISPDDYEDATGSVAPMAFLPVGNGLSLGDVCRNEGGTPIDS
RKLNRTLTFDSGSGAIRCEAGVSLAELLARAAPHRFFLPVTPATGLVTVGGAVANDIHGG
NHHARGSFGNHVRRLTLLRSSGERLVCTPEENAELFAATIGGLGLTGLILDVELRLMKVP
SPHVQRHVLRFDSLEQYFALAERAAEEHEYCVAWLDQLATGRRAGRGVLFAADHADGACE
LPDVLKRPKLAVPVSPPFSLFNRLTLRALNEYRFRKAGTGETVSTEDWPSYFHRLDAVGG
WGRLYGRRGFCQHHSVYPAATAPETTARLLEAARRAGHASVRTTLQRFGDIASRGLLSFA
RPGFTLILDFANQGRATVKLLDTLDEIVISAGGAVNPCQDFRMSRAVFEASFPSWKRLEA
LRDPAIVSDFWRRTALATGTT
Download sequence
Identical sequences A6U8D7
gi|150396285|ref|YP_001326752.1| WP_011975241.1.29075 WP_011975241.1.31871 WP_011975241.1.61285 WP_011975241.1.7720 WP_011975241.1.89664 YP_001326752.1.44884 366394.Smed_1064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]