SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396293|ref|YP_001326760.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396293|ref|YP_001326760.1|
Domain Number 1 Region: 137-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.69e-125
Family Enolase 0.000000025
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.73e-55
Family Enolase N-terminal domain-like 0.00000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396293|ref|YP_001326760.1|
Sequence length 424
Comment phosphopyruvate hydratase [Sinorhizobium medicae WSM419]
Sequence
MTAIIDIIGREILDSRGNPTVEVDVHLEDGSFGRAAVPSGASTGAHEAVELRDGGTRYLG
KGVERAVDAVNGEIFEAIGGLDAENQIQIDRTMFELDGTPNKSRLGANAILGVSLAVAKA
AAEAAGLPLYRYVGGPNAHLLPVPMMNIINGGAHADNPIDFQEFMIMPVGAETLKDAVRM
GSEVFHTLKKQLAADGHNTNVGDEGGFAPGLASAPAALDFIMKSIEKAGYRPGEDMYVAL
DCASTEFFKDGKYVLEGEGRTLEPGAMAEYLAELAGKYPIVSIEDGMAEDDWDGWKALTD
LIGNKCQLVGDDLFVTNSARLRDGIKMGVANSILVKVNQIGSLSETLDAVETAHKARYTA
VMSHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEQLGPQAQYAGRS
ILRG
Download sequence
Identical sequences A6U8E5
WP_011975249.1.29075 WP_011975249.1.7720 YP_001326760.1.44884 gi|150396293|ref|YP_001326760.1| 366394.Smed_1072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]