SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396322|ref|YP_001326789.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396322|ref|YP_001326789.1|
Domain Number 1 Region: 117-267
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.83e-33
Family Reductases 0.0000223
Further Details:      
 
Domain Number 2 Region: 18-113
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.32e-25
Family Ferredoxin reductase FAD-binding domain-like 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396322|ref|YP_001326789.1|
Sequence length 270
Comment oxidoreductase FAD-binding subunit [Sinorhizobium medicae WSM419]
Sequence
MNAPAKKEDFAVQAPAGVFVETVTSVEHYTDRLFRFRMTRPKEFRFRSGEFAMIGLMVGD
KPIYRAYSIASPAWDEELEFFSIKVPDGPLTSHLQGIKPGDQVLMRKKPTGTLVLDALVP
GRRLYMFSTGTGIAPFASLIRDPETFEKFEEVILTHTCRDVAELKYGFDLVDEIRNHEFL
NEVVGNKLRHYATVTREDYSYKGRITDLMNNGKFFADLGLQPLDPVIDRGMICGSTAMLK
DTKEILEAAGLTEGANNKPAEFVIERAFVG
Download sequence
Identical sequences A6U8H4
gi|150396322|ref|YP_001326789.1| 366394.Smed_1103 WP_011975277.1.29075 WP_011975277.1.31871 WP_011975277.1.61285 WP_011975277.1.7720 WP_011975277.1.89664 YP_001326789.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]