SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150396381|ref|YP_001326848.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396381|ref|YP_001326848.1|
Domain Number 1 Region: 106-179
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-25
Family ScpB/YpuH-like 0.00073
Further Details:      
 
Domain Number 2 Region: 30-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000453
Family ScpB/YpuH-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150396381|ref|YP_001326848.1|
Sequence length 242
Comment putative transcriptional regulator [Sinorhizobium medicae WSM419]
Sequence
MAEAQKILPVLPDGEDDAEEASVAPRLEREAERIAEALVFASAQPVSETYIAGRLPRGTD
VGSVMARLKSRYAGSGVNLVQVADHWAFRTAADLSFVVQTEEQEVRKLSRAALEVLAIIA
YHQPVTRAEIEDIRGVQTSKGTLDVLMEAGWVRFRGRRRSPGRPVTFGTTRDFLDHFGLE
EIRDLPGIDELKGAGLLSGRVPSSLNIPVPVGEDEFSDNEDPITQMDLEELGLLTPKAEE
DD
Download sequence
Identical sequences A6U8N3
YP_001326848.1.44884 gi|150396381|ref|YP_001326848.1| 366394.Smed_1162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]