SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396382|ref|YP_001326849.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396382|ref|YP_001326849.1|
Domain Number 1 Region: 27-267
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.26e-76
Family ABC transporter ATPase domain-like 0.00000507
Further Details:      
 
Domain Number 2 Region: 261-366
Classification Level Classification E-value
Superfamily MOP-like 0.00000368
Family ABC-transporter additional domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396382|ref|YP_001326849.1|
Sequence length 372
Comment ABC transporter-like protein [Sinorhizobium medicae WSM419]
Sequence
MQSMASDARNGAVMMTRRSGVSFAANLAFENISHRYHSKDTIKGVTLKAEAGEVLCLLGP
SGSGKTTLLRIAAGIEMQTGGRLLLNGQEISGPSVFVPPEKRGVGLMFQDFALFPHMTIR
ENVCFGLTELPKNKALMQADTALERVGLLHYAERYPHVLSGGEQQRVALARALAPRPAVL
LMDEPFSGLDSRLKDSIRADTLAILRETRATAIVVTHDAEEAMRMADRIALLRDGRLIQV
GTADELYRRPCDLFTAGFFSEINVFDGRVRDGRVETPLGVVAAGQYAEGQLLNVAVRLSG
IHLDEEGGEIPARIVSRRFLGVVELLELAVPQSERTVRARIRADLLPQGLRDITLSVNER
DILVFEKDASTP
Download sequence
Identical sequences A6U8N4
WP_011975333.1.29075 WP_011975333.1.61285 WP_011975333.1.7720 YP_001326849.1.44884 366394.Smed_1163 gi|150396382|ref|YP_001326849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]