SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396457|ref|YP_001326924.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396457|ref|YP_001326924.1|
Domain Number 1 Region: 32-175,204-497
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.83e-104
Family Arylsulfatase 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150396457|ref|YP_001326924.1|
Sequence length 554
Comment sulfatase [Sinorhizobium medicae WSM419]
Sequence
MNRRIICGVGALAASTVLWGALAPVQAQETRKPNILFIVSDDTGYGDLGPYGGGEGRGMP
TPNIDKLADEGMTFFSFYAQPSCTPGRAAMQTGRIPNRSGMTTVAFQGEGGGLPAAEWTL
ASVLKRGGYQTYFTGKWHLGEADYALPIAQGYDEMKYVGLYHLNAYTYADATWFPDMDPE
LRAMFQKVTKGSLSGKAGGEVTEDFKINGQYVDTPVIDGKPGVVGIPFFDGYVEKAAIEF
LDAAAKKPDQPFYINVNFMKVHQPNLPAPEFQHKSLSKTKYADSVVELDTRIGRILDKLR
ETGMDRNTLVFYTTDNGAWQDVYPDAGYTPFRGTKGTVREGGNRVPAIAVWPGKIKPSSK
NHDIVGGLDLMATFAAAGGVPLPDKDREDKPIVFDSYDMSPVLLGTGKSARKSWFYFTEN
ELTPGAARVGNYKAVFNLRGDNGQSTGGLAVDSNLGWKGAESYVATVPQVFDLWQDPQER
YDIFMNNYTEHTWTMVSISNAIEELMKTYVQHPPRKLQSESYSGPLTITSYQRFEWARQQ
LGKEGVNIPLPTGN
Download sequence
Identical sequences A6U8V9
366394.Smed_1239 gi|150396457|ref|YP_001326924.1| WP_011975401.1.61285 WP_011975401.1.7720 YP_001326924.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]