SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396574|ref|YP_001327041.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396574|ref|YP_001327041.1|
Domain Number 1 Region: 35-534
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.62e-142
Family Alkylsulfatase-like 0.0000000000517
Further Details:      
 
Domain Number 2 Region: 543-663
Classification Level Classification E-value
Superfamily SCP-like 1.53e-27
Family Alkylsulfatase C-terminal domain-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396574|ref|YP_001327041.1|
Sequence length 687
Comment beta-lactamase domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MNGLLKLLSLVIGAVFAGGLGGTAVAQEPQHFSPKGKMPSQYTIEAQQQQRQLLPFADKR
DFEEAKRGFIAAPPFRQIMNDKGDVAWNMDNWDFLLKGMEFDSIHPSLQRQALLNMEYGL
FEVVPGIYQIRGFDLANISFIKGDTGWIVIDPLTVKETARAALKFINEKLGERPVVAVII
SHSHGDHFGGIRGVVDDAALAAEKVQIIAPKGFLNEAIAENLYAGNVMTRRKSYTYGDLV
PPSPYGHVDASIGKAVASGDVGILPPTISIDQPIQELTIDGVRMVFQNTPGTEAPAEMNT
WFPDFKAFWAAENIVGSLHNILTLRGAPVRDALAWSQYINLALYQFGNQADVMFASHSWP
RWGKERITEVMRGQRDMYANLNNQVLHLANKGVTINQIHNVYEPPKSLQQQWHSRGYHGS
YLHNSRAVIQRYLGFWDLNPATLVPLSPEESAPLYVEMMGGGSKVMAKGRDLYAEGKYRL
ATEILNKLVYAEPDNQEAKDLLADTYEQMGYQFESPSLRHSFLAGAKELRDGVVAVKAAK
AGSPDFVRGTSTELFLNYLGIQMESGKAEGMTFKINLSTPDNGEKFVLEMSNATLTTIAG
YQAEDADLTVTIDRRELEDVMIGTATLSDKVSSGKAKMEGNPQVLAQLGSTMVMFDNWFE
VLPGTKKREALPKPELFQDDATRYEGP
Download sequence
Identical sequences A6U976
gi|150396574|ref|YP_001327041.1| 366394.Smed_1358 WP_011975516.1.7720 YP_001327041.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]